AJP - Lung Add DOIs to your references at manuscript stage!
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


Am J Physiol Lung Cell Mol Physiol 289: L842-L848, 2005. First published June 17, 2005; doi:10.1152/ajplung.00286.2004
1040-0605/05 $8.00
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow All Versions of this Article:
289/5/L842    most recent
00286.2004v1
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in ISI Web of Science
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via ISI Web of Science (24)
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Shaykhiev, R.
Right arrow Articles by Bals, R.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Shaykhiev, R.
Right arrow Articles by Bals, R.

Human endogenous antibiotic LL-37 stimulates airway epithelial cell proliferation and wound closure

Renat Shaykhiev,1 Christoph Beißwenger,1 Kerstin Kändler,1 Judith Senske,1 Annette Püchner,1 Thomas Damm,1 Jürgen Behr,2 and Robert Bals1

1Hospital of the University of Marburg, Department of Internal Medicine, Division of Pulmonary Diseases, Philipps-Universtät Marburg, Marburg; and 2Hospital of the University of Munich, Department of Internal Medicine I, Division of Pulmonary Diseases, Ludwig-Maximilians-Universtät Munich, Munich, Germany

Submitted 26 July 2004 ; accepted in final form 7 June 2005


    ABSTRACT
 TOP
 ABSTRACT
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 GRANTS
 REFERENCES
 
Antimicrobial peptides are endogenous antibiotics that directly inactivate microorganisms and in addition have a variety of receptor-mediated functions. LL-37/hCAP-18 is the only cathelicidin found in humans and is involved in angiogenesis and regulation of the innate immune system. The aim of the present study was to characterize the role of the peptide LL-37 in the regulation of wound closure of the airway epithelium in the cell line NCI-H292 and primary airway epithelial cells. LL-37 stimulated healing of mechanically induced wounds in monolayers of the cell line and in differentiated primary airway epithelium. This effect was detectable at concentrations of 5 µg/ml in NCI-H292 and 1 µg/ml in primary cells. The effect of LL-37 on wound healing was dependent on the presence of serum. LL-37 induced cell proliferation and migration of NCI-H292 cells. Inhibitor studies in the wound closure and proliferation assays indicated that the effects caused by LL-37 are mediated through epidermal growth factor receptor, a G protein-coupled receptor, and MAP/extracellular regulated kinase. In conclusion, LL-37 induces wound healing, proliferation, and migration of airway epithelial cells. The peptide is likely involved in the regulation of tissue homeostasis in the airways.

airway epithelium; antimicrobial peptide; wound healing; cathelicidin; tissue repair


THE RESPIRATORY TRACT IS SHIELDED by a multicomponent host defense system (29). The conducting airways rely on an integral epithelial surface to support clearance, barrier function, and host defense. Airway epithelial cells represent an important structural and functional component of lung tissue homeostasis (23). Epithelial injury is a hallmark of several inflammatory lung diseases such as asthma, chronic obstructive pulmonary disease, or pulmonary fibrosis. In response to epithelial injury, repair processes are initiated that comprise cell migration, proliferation, and differentiation (19, 32). Inflammation is associated with epithelial injury and with increased expression of mediatory molecules. Some of these molecules such as keratinocyte growth factor (22) or epidermal growth factor (EGF) (24) are involved in the regulation of epithelial repair processes. Also antimicrobial peptides regulate epithelial reconstitution. Human neutrophil defensins induce airway epithelial proliferation and wound closure (1, 2).

Antimicrobial peptides are endogenous antibiotics that directly inactivate microorganisms (34). Cathelicidins are a family of antimicrobial peptides characterized by a highly conserved signal sequence and proregion ("cathelin") but show substantial heterogeneity in the COOH-terminal domain that encodes the mature peptide (8, 21). LL-37/hCAP-18 is the only cathelicidin in humans and is encoded by the gene CAMP. The cDNA was cloned from human bone marrow (12, 15). LL-37/hCAP-18 is expressed in myeloid cells and epithelial cells of the skin and the gastrointestinal, urinary, and respiratory tract (7, 14, 15). In addition to its direct antimicrobial function, LL-37 activates cells through receptors including the formyl peptide receptor-like 1 (FPRL1) (31) and the P2X7 receptor (13). Receptor-mediated activities include stimulation of angiogenesis (20), cutaneous wound healing (16), and chemoattraction of inflammatory and immune cells (3, 31). LL-37 activates airway epithelial cells involving the mitogen-activated protein kinase (MAPK)/extracellular signal-regulated kinase (ERK) and stimulates the release of IL-8 (27). Increased concentrations of LL-37 in the airways have been found in inflammatory (4) and infectious lung disease (25). On the basis of its activities, it appears that LL-37/hCAP-18 is involved in the pathogenesis of lung disease; however, it is unknown whether LL-37 influences the repair processes of airway epithelial cells.

It was the aim of the present study to characterize the role of the cathelicidin peptide LL-37/hCAP-18 in airway epithelial wound closure. We found that LL-37 induces the closure of epithelial wounds, stimulates epithelial proliferation, and chemoattracts epithelial cells.


    MATERIALS AND METHODS
 TOP
 ABSTRACT
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 GRANTS
 REFERENCES
 
Cell types and culture conditions. The bronchial mucoepidermoid carcinoma-derived cell line NCI-H292 (ATCC, Manassas, VA) (9) was cultured at 37°C in 5% CO2 in RPMI-1640 (GIBCO, Grand Island, NY) supplemented with 2 mM L-glutamine, 100 U/ml penicillin, and 100 µg/ml streptomycin (PAA Laboratories, Pasching, Austria) and containing 10% heat-inactivated fetal bovine serum (FBS, GIBCO). The culture medium was changed every 2 days. Cells were passaged every 5 days with 0.25% trypsin and 0.1% EDTA (PAA Laboratories). Human bronchial cells were isolated and cultivated as conventional submersed cultures or as air liquid interface cultures as described earlier (6). The protocol was approved by the ethics committee of the University of Marburg and informed consent was obtained from the donors. We selected cultures for experiments by measuring the transepithelial resistance (Rt) using an epithelial ohmmeter (EVOM; World Precision Instruments, Sarasota, FL). Cultures were considered confluent and differentiated if the Rt was >500 {Omega}·cm2.

In vitro wound closure assay. NCI-H292 and primary cells were grown to confluence in six-well tissue culture plates. Three to ten circular wounds (from 1 to 2.5 mm in diameter) were scraped in each well with a sterile pipette tip. The wounded monolayers were rinsed with culture medium to remove all cellular debris, and the following experimental conditions were applied: 1) LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH) at the indicated concentrations, 2) transforming growth factor alpha (TGF-{alpha} 20 ng/ml, positive control; Sigma-Aldrich Chemie, Munich, Germany), and 3) culture medium with or without 10% FBS. A scrambled version of LL-37 (sLL-37, sequence RSLEGTDRFPFVRLKNSRKLEFKDIKGIKREQFVKIL-COOH) was used in selected experiments to exclude a nonspecific effect of LL-37. The wound area was determined videomicroscopically immediately after wound creation and at different postwounding time points (24 and 48 h) and expressed as percentage of the area measured immediately after wounding. The wound area was examined with an inverted microscope (Axiovert 25; Carl Zeiss, Oberkochen, Germany), using the Evolution LC Megapixel FireWire Camera Kit bundled with Image-Pro Discovery software (Media Cybernetics, Silver Spring, MD) and a video monitor. After the image was acquired, the measurement data were converted from pixels to millimeters using a calibration image. The wound edges were examined for the presence and intensity of lamellipodia formation by a videomicroscopy technique. We calculated the relative lamellipodia area by dividing the total lamellipodia area by the cell number within the examined wound edge. For inhibitor studies, mechanically wounded NCI-H292 cells were exposed to inhibitors of MEK (PD-98059, 25 µM; Alexis, Nottingham, UK), p38 MAPK (SB-203580, 10 µM; Calbiochem, La Jolla, CA), P2X7 receptor (KN-62, 10 mM; Calbiochem), G protein-coupled receptor (GPCR) signaling [pertussis toxin (PTx) 50 ng/ml; Sigma], or EGF receptor (EGFR) tyrosine kinase (AG-1478, 1 µM; Calbiochem) 1 h before addition of stimuli. To evaluate the role of FPRL1 as a possible receptor for LL-37, some wounded monolayers were incubated with HRYLPM-COOH peptide recently described as a full and selective activator of FPRL1 (5). Because most inhibitors used in our study affect the principal signaling mechanisms essential for basal epithelial repair process, we calculated the inhibition index (the "inhibition" area related to the remaining wound area at the given time point). Such a parameter allows us to compare contribution of a targeted pathway on the wound closure in differently stimulated groups when both of the groups are sensitive to the inhibitor. To study the effect of LL-37 on the repair of differentiated airway epithelial cells, we mechanically damaged the cultures in air-liquid interface with sterile pipette tip, scraping off a ring of cells (from 2 to 3 mm in diameter) without damaging to the filter support. Wound healing was assessed by the measurement of Rt at different time points. The results were expressed as Rt recovery, indicating an increase of Rt (%) compared with the immediate postwounding value.

Cell migration assay. Cell migration of NCI-H292 cells was measured by a modified Boyden's chamber technique using a 96-well multiwell chamber (Neuroprobe, Bethesda, MD) (10). Culture medium containing one of the following stimuli was placed into the bottom wells: 1) LL-37 at concentrations from 1 to 20 µg/ml, 2) insulin-like growth factor 1 (IGF-1, 100 ng/ml; Sigma Aldrich) as positive control, 3) TGF-{alpha} (20 ng/ml) as additional positive control, 4) sLL-37, or 5) culture medium alone. The wells were covered with a polyvinylpyrrolidone-free 8-µm-pore polycarbonate filter (Neuroprobe, Gaithersburg, MD) coated with 0.01% collagen type I solution (Sigma Aldrich). Shortly before the experiment, the cells were detached with 0.05% trypsin and 5 mM EDTA. We placed 105 cells in 50 µl into each of the top wells. Then the chamber was incubated for 6 h. After incubation, we removed the filter and removed cells on the top surface of the filter by scraping. We fixed the migrated cells on the lower side of the filter by placing the filter in 100% methanol overnight. The filter was stained with Haemalaun (Waldeck, Division Chroma, Münster, Germany) for 20 min and then washed in water. Cell migration was quantified and expressed as the number of stained cells on the lower surface of the filter in three random fields viewed under a light microscope at x20 magnification. The experiments were performed under both serum-free and serum-containing (10% FBS) culture conditions.

Cell proliferation assay. NCI-H292 cells were seeded at a density of 104 cells/ml on Lab-Tek II eight-chamber glass slides (Nalge Nunc International, Naperville, IL). At subconfluence, the cells were incubated with various stimuli (LL-37, sLL-37, TGF-{alpha}) at concentrations as in the migration assay or medium alone for 48 h. Cell proliferation was evaluated by 5-bromo-2-deoxy-uridine (BrdU) incorporation method using the BrdU labeling and detection kit II (Roche Diagnostics) following the manufacturer's protocol. The cells were incubated with 10 µM BrdU for 1 h. After the aspiration of the BrdU-labeling medium and washing, the cells were fixed in 70% ethanol at –20°C for 30 min. The proliferation index was calculated as the number of BrdU-positive cells divided by the total number of cells, multiplied by 100. At least 600 cells from each experimental group were counted. To investigate the possible involvement of selected signaling pathways, we performed inhibitor studies in each individual experiment, using the inhibitors described above. Confluent NCI-H292 cell monolayers grown on Lab-Tek II glass slides were wounded and incubated with various stimuli as described above. At different time points after injury (24 and 48 h), a BrdU assay was performed. Then the wound edges and postwounding areas were analyzed for the presence of BrdU-positive cells.

Measurement of FPRL1, P2Y7, and LL-37/hCAP-18 expression. RT-PCR was performed using total RNA from NCI-H292 or primary airway epithelial cells (RNeasy Mini Kit; Qiagen, Hilden, Germany), the cDNA synthesis kit (MBI Fermentas, St. Leon-Rot, Germany), and the following primers (TIB Molbiol, Berlin, Germany): human {beta}-actin (sense 5'-AGA GCT ACG AGC TGC CTG AC-3', antisense 5'-AGC ACT GTG TTG GCG TAC AG-3', annealing temperature 60°C), LL-37 (sense 5'-CCA CCA TGG GCC TGG TGA TGC CTC TGG CCA TC-3', antisense 5'-TGT ACA CTA GGA CTC TGT CCT GGG TAC AAG-3', annealing temperature 65°C), FPRL1 (sense 5'-TGG TTG CCC TTC TGG GCA CC-3', antisense 5'-CTC TCG GAA GTC TTG GCC CAC-3', annealing temperature 65°C), P2X7 (18) (sense 5'-CCC CGG CCA CAA CTA CAC CAC GAG AAA C-3', antisense 5'-CCG AG TAG GAG AGG GTT GAG CCG ATG-3', annealing temperature 67°C). Quantitative PCR results were obtained by the {Delta}{Delta}Ct (cycle threshold) method. For qualitative analysis, PCR products were subjected to electrophoresis on a 1.5% agarose gel, and DNA was visualized by ethidium bromide staining.

Cytotoxicity and apoptosis assays. The cytotoxic effect of different concentrations of LL-37 and sLL-37 on NCI-H292 and primary airway epithelial cells was assessed by colorimetric quantification of the lactate dehydrogenase (LDH) concentration in cell supernatants using the Cytotoxicity Detection Kit (Roche Diagnostics, Mannheim, Germany) according to the manufacturer's instructions. The effect of LL-37 on apoptosis of NCI-H292 cells was determined by the annexin binding apoptosis assay according to the manufacturer's instruction (Vybrant apoptosis assay; Molecular Probes, Eugene, OR).

Statistical analysis. For all experiments, duplicate or triplicate determinations were made for each experimental condition. The results of replicates were averaged and expressed as one data point. Each experiment was repeated at least two times. All data are expressed as means ± SE. Comparisons between experimental groups were performed by Student's t-test or the analysis of variance (ANOVA) as appropriate. For time-course experiments, ANOVA was used to compare the data for multiple time points and different conditions. Post hoc range tests were performed with the t-test (two-sided) with Bonferroni adjustment. Results were considered statistically significant for P values <0.05.


    RESULTS
 TOP
 ABSTRACT
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 GRANTS
 REFERENCES
 
LL-37 increases the closure of airway epithelial wounds. To evaluate the effect of LL-37 on bronchial epithelial wound closure in vitro, confluent monolayers of NCI-H292 and primary cells were mechanically damaged and then exposed to LL-37, TGF-{alpha}, or medium. LL-37 treatment resulted in a dose-dependent increase of wound closure in NCI-H292 (Fig. 1A) cell monolayers. The stimulatory effect of LL-37 on wound closure was dependent on the presence of serum (Fig. 1A). sLL-37 did not have any stimulatory effect, suggesting that LL-37-stimulated wound closure is a specific effect of the peptide. LL-37 stimulates airway epithelial wound closure in vitro at 5 µg/ml. The biological properties of cell lines differ significantly from those of primary cells. Therefore, the effect of LL-37 on primary airway epithelial cells was tested (Fig. 1B). LL-37 had no effect on primary cells grown as submersed nondifferentiated monolayers (data not shown). When the epithelial cells were allowed to differentiate in air-liquid interface culture, a significantly faster increase of Rt was detected in the LL-37-treated group compared with the negative control (Fig. 1B). To study whether the effect of LL-37 is due to accelerated migration, the wound edges were examined for the presence of lamellipodia, which were significantly increased in the LL-37-treated group (Fig. 2).



View larger version (23K):
[in this window]
[in a new window]
 
Fig. 1. Effect of LL-37 on bronchial epithelial wound closure. Mechanically wounded NCI-H292 (A) cells were incubated with different concentrations of LL-37, transforming growth factor (TGF)-{alpha}, HRY (FPRL agonistic peptide), and scrambled (s) LL-37. The remaining wound area (percentage of residual wound area compared with t = 0 h) was measured after 24 and 48 h. SFM, serum-free medium. *P < 0.05 compared with the medium group (n = 15, per group). Differentiated airway epithelial cells in air-liquid interface culture (B) were wounded, and the wound closure was determined by measurement of transepithelial resistance (Rt). *P < 0.05 compared with the medium group (n = 3 per group).

 


View larger version (75K):
[in this window]
[in a new window]
 
Fig. 2. LL-37 increases the formation of lamellipodia at the wound edge of NCI-H292 cells treated with 5 µg/ml LL-37 (A). Formation of lamellipodia (arrow, C) at the wound edge treated with 5 µg/ml LL-37 (A) or in control cells (B). *P < 0.05 (n = 5 per group).

 
LL-37-induced wound closure involves multiple signaling pathways. To investigate whether the stimulatory effect of LL-37 on airway epithelial wound closure involves an EGFR-dependent mechanism or GPCR-mediated signaling, we exposed mechanically wounded NCI-H292 monolayers to the EGFR tyrosine kinase inhibitor (AG-1478) or PTx. LL-37 was used at a concentration of 5 µg/ml. To gain insight into the possible downstream signaling mechanisms, inhibitors of MEK (PD-98059) and p38 MAPK (SB-203580) were used. PTx pretreatment significantly decreased the stimulatory effect of LL-37 at both time points (24 and 48 h after wounding), as did AG-1478 and to a lesser degree PD-98059 (Fig. 3). LL-37 is known to activate the receptors FPRL1 and P2X7. FPLR1 transcripts were found to be expressed by primary but not NCI-H292 cells; P2X7 transcripts were detected in both cell types (data not shown). A specific ligand of FPRL1, the peptide HRYLPM, did not induce epithelial wound healing. A specific inhibitor of P2X7 (KN-62) did not reduce LL-37-induced wound healing. Levels of FPRL1 and P2Y7 expression were not increased in wounded NCI-H292 cells. As described earlier, LL-37 is expressed in airway epithelial cells (7) and was not found to be increased after wounding in NCI-H292 cells in the present study (data not shown).



View larger version (15K):
[in this window]
[in a new window]
 
Fig. 3. Effects of inhibitors of selected signaling pathways on LL-37-stimulated bronchial epithelial wound closure. Wounded NCI-H292 monolayers were preincubated with pertussis toxin (PTx), AG-1478 (AG), KN-62, PD-98059 (PD), or SB-203580 (SB) before addition of LL-37 (5 µg/ml). The remaining wound area was determined 24 and 48 h after stimulation, and the inhibition index was calculated as described in MATERIALS AND METHODS. *P < 0.05 compared with the medium group (n = 5 per group).

 
LL-37 is chemotactic for bronchial epithelial cells. Because LL-37 enhances airway epithelial wound closure, it is reasonable to believe that LL-37 stimulates epithelial cell migration. We used LL-37 in a modified Boyden's chamber and found that LL-37 stimulated NCI-H292 migration in a concentration-dependent manner (Fig. 4A). There was no stimulation of migration in cells treated with sLL-37. In contrast to wound closure, the effect of LL-37 on NCI-H292 cell migration in this chemotaxis assay was not modified induced by the presence of serum (data not shown).



View larger version (23K):
[in this window]
[in a new window]
 
Fig. 4. Dose-dependent effects of LL-37 on NCI-H292 cell migration and proliferation. A: Boyden chamber assay. LL-37, IGF-1, TGF-{alpha}, or sLL-37 was placed into each of the bottom wells. Cell migration was quantified as the number of stained (migrated) cells on the lower surface of the filter in 3 random fields under a light microscope at x20 magnification. *P < 0.05 compared with the cells in the medium group (n = 4 per group). B: 5-bromo-2-deoxy-uridine (BrdU) incorporation assay. NCI-H292 cells were incubated with BrdU in the presence of LL-37 or under control conditions (medium, sLL-37, TGF-{alpha}) for 48 h. To assess the signaling mechanisms the inhibitors PTx, AG-1478, SB-203580, and PD-98059 were applied before stimulation with LL-37 (20 µg/ml). The number of BrdU-positive cells was determined 48 h after incubation with LL-37. Data are expressed as a percentage of the BrdU-positive cells (BrdU incorporation index). *P < 0.05 compared with the medium group (LL-37, TGF-{alpha}) or to the 20 µg/ml LL-37 group (sLL-37, inhibitor groups) (n = 4 per group).

 
LL-37 stimulates bronchial epithelial cell proliferation. Cell proliferation is one component of wound healing. To determine whether LL-37 stimulates bronchial epithelial cell proliferation, we measured BrdU incorporation in NCI-H292 cells 48 h after stimulation with LL-37 (1–20 µg/ml), sLL-37, TGF-{alpha}, and IGF-1 (positive controls), or medium alone. LL-37 increased NCI-H292 labeling with BrdU in a concentration-dependent manner (Fig. 4B). Treatment with sLL-37 at the equivalent concentrations had no significant effect on NCI-H292 proliferation. To characterize the signaling pathways involved, we preincubated NCI-H292 cells with one of the following inhibitors: PTx, EGFR inhibitor AG-1478, MEK inhibitor PD-98059, or p38 MAPK inhibitor SB-203580, before stimulation with 20 µg/ml LL-37 or serum-free medium alone. As shown in Fig. 4B, pretreatment with AG-1478 completely blocked LL-37-stimulated NCI-H292 cell proliferation, whereas PTx caused only moderate decrease of BrdU incorporation in LL-37-treated cells. LL-37 increased NCI-H292 proliferation was minimally inhibited by p38 MAPK inhibitor SB-203580 but was significantly suppressed by preincubation with MEK inhibitor PD-98059. To determine whether cell proliferation contributes to the LL-37-induced wound healing, the wounded monolayers were incubated with BrdU, and the incorporation was detected. We found no increase of stained cells at the wound edge compared with the control group or a region remote from the wound edge (data not shown).

High concentration of LL-37 is cytotoxic for airway epithelial cells. To determine the cytotoxic effects of LL-37, we performed LDH release assays with NCI-H292 and primary airway epithelial cells. LL-37 induced significant release of LDH at concentrations >20 µg/ml (Fig. 5, A and B). No significant effect of LL-37 on apoptosis was found in an annexin binding assay compared with the induction of necrotic cell death (Fig. 5C).



View larger version (16K):
[in this window]
[in a new window]
 
Fig. 5. Cytotoxic effects of LL-37 on airway epithelial cells. LDH release from NCI-H292 (A) and primary cells (B) was measured in response to the indicated concentrations of LL-37. C: LL-37 exposure did not induce apoptosis in an annexin binding assay in NCI-H292 cells but did result in increased necrotic cell death. *P < 0.05 compared with the medium group (n = 4 per group).

 

    DISCUSSION
 TOP
 ABSTRACT
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 GRANTS
 REFERENCES
 
The main finding of the present study is that the cathelicidin antimicrobial peptide LL-37 stimulates wound healing of human airway epithelial cells. The peptide induces cell proliferation and chemotaxis of epithelial cells. The intracellular signaling after stimulation with LL-37 involves GPCR, EGFR, and MEK.

Antimicrobial peptides are classically regarded as endogenous antibiotics that provide a first line of host defense until other components of the innate immune system or the adaptive immune system becomes active and functional. Increasing evidence from in vivo studies accumulated during the last few years and proved that host defense is indeed one of the main functions of vertebrate antimicrobial peptides (34). In parallel it became clear that antimicrobial peptides may possess additional functions. It is known that several antimicrobial peptides bind to cellular receptors and induce specific cellular reactions (30). Human neutrophil defensins induce lung epithelial cell proliferation and wound closure in vitro (1, 2). Also LL-37 appears to be involved in the regulation of processes of epithelial cells. The peptide regulates the wound repair of cutaneous wounds (16, 33). Furthermore, it activates epithelial cells of the airways (27). LL-37 interacts at least with two receptors, the FPRL1 and the P2X7 receptor. The data demonstrated here show that the peptide LL-37 is involved in the regulation of airway epithelial wound closure.

The induction of wound closure by LL-37 occurs at relatively low levels that are well in the range of the concentration that can be found during inflammation or infection (4, 11, 25). The exact concentrations of LL-37 at which cells are physiologically exposed are not known. Higher concentrations have detrimental effects on airway epithelial cells as indicated by the LL-37-induced release of IL-8 (27) or the induction of necrosis as demonstrated here. Epithelial injury is normally followed by a complex repair process that comprises epithelial migration, proliferation, and differentiation. These processes are mediated by intracellular signaling cascades including the EGFR pathway (24). The proinflammatory effect of LL-37 on airway epithelial cells seen at high concentrations is mediated by transactivation of the EGFR via metalloprotease-mediated cleavage of membrane-anchored EGFR-ligands and mediated by MAPK (27). The present results also indicate that GPCR signaling and EGF receptor activation are the principal pathways used by LL-37 to stimulate bronchial epithelial restitution after mechanical injury. MEK appears to act as a downstream signaling element. Activation of cell proliferation involves a specific pattern of intracellular signaling where the GPCR and MAPK p38 have a less important role compared with wound healing. It is unclear which cellular receptors mediate the LL-37-induced wound healing. The involvement of the GPCR in the wound healing process is likely since PTx inhibits wound healing significantly. FPRL1 has been shown to be expressed in primary airway epithelial cells (17), but its involvement in LL-37 induced wound healing is uncertain. In the present study the LL-37-dependent effect could not be duplicated by an agonist of FPRL1. The relative independence of the cell proliferation from GPCR indicates that the effect of LL-37 could be mediated by several distinct receptors. It is also not clear whether P2X7 is involved in this process. An inhibitor of this receptors did not influence LL-37-induced wound healing. The effect of LL-37 on wound closure was observed only in the presence of serum, suggesting a possible interaction between the peptide and one or several components of serum.

The effect of LL-37 was detected in a cell line and in primary airway epithelial cells. This is important because it is known that cells lines often behave quite differently from primary cells. Intriguingly, we could observe the peptide's effect only on well-differentiated epithelial cells. Air-liquid interface cultures are often used to study effects of the airway epithelium that are dependent on differentiation, polarization, and the formation of tight junctions. Wound healing involving the EGF system is known to depend on the polarization of the epithelium (28). Several reasons could account for the dependence of LL-37 on the differentiation status: 1) the receptor necessary for LL-37-induced wound healing is present only in differentiated primary cells, 2) the assay used to study wound closure in nondifferentiated primary cells is inadequate to detect LL-37-induced wound healing, 3) the effect of LL-37 depends on a polarized state of the epithelium. Primary cells and also the cell line used in the study are capable of producing LL-37, making an autocrine mechanism for regulation of wound healing likely. Other epithelial cells are also capable to regulate repair processes in an autocrine manner (26).

In conclusion, we show that LL-37 induces airway epithelial wound healing. LL-37 induces proliferation and migration of airway epithelial cells. This effect is mediated by signaling pathways involving the EGFR, GPCR, and MAPK. In addition to its host defense function and modulatory effect on the innate immune system, LL-37 might play an important role in the homeostasis of the airway epithelium and the maintenance of the integrity of the respiratory tract.


    GRANTS
 TOP
 ABSTRACT
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 GRANTS
 REFERENCES
 
This study was supported by Cystic Fibrosis Foundation Grant BALS03G0 and Deutsche Forschungsgemeinschaft Grant DFG1641/5-1 to Robert Bals.


    FOOTNOTES
 

Address for reprint requests and other correspondence: R. Bals, Dept. of Internal Medicine, Div. of Pulmonary Diseases, Hospital of the Univ. of Marburg, Baldingerstr. 1, 35043 Marburg, Germany (e-mail: bals{at}mailer.uni-marburg.de)

The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.


    REFERENCES
 TOP
 ABSTRACT
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 GRANTS
 REFERENCES
 

  1. Aarbiou J, Ertmann M, van Wetering S, van Noort P, Rook D, Rabe KF, Litvinov SV, Van Krieken JH, De Boer WI, and Hiemstra PS. Human neutrophil defensins induce lung epithelial cell proliferation in vitro. J Leukoc Biol 72: 167–174, 2002.[Abstract/Free Full Text]
  2. Aarbiou J, Verhoosel RM, van Wetering S, De Boer WI, Van Krieken JH, Litvinov SV, Rabe KF, and Hiemstra PS. Neutrophil defensins enhance lung epithelial wound closure and mucin gene expression in vitro. Am J Respir Cell Mol Biol 18: 30, 193–201, 2004.
  3. Agerberth B, Charo J, Werr J, Olsson B, Idali F, Lindbom L, Kiessling R, Jornvall H, Wigzell H, and Gudmundsson GH. The human antimicrobial and chemotactic peptides LL-37 and alpha-defensins are expressed by specific lymphocyte and monocyte populations. Blood 96: 3086–3093, 2000.[Abstract/Free Full Text]
  4. Agerberth B, Grunewald J, Castanos-Velez E, Olsson B, Jornvall H, Wigzell H, Eklund A, and Gudmundsson GH. Antibacterial components in bronchoalveolar lavage fluid from healthy individuals and sarcoidosis patients. Am J Respir Crit Care Med 160: 283–290, 1999.[Abstract/Free Full Text]
  5. Bae YS, Yi HJ, Lee HY, Jo EJ, Kim JI, Lee TG, Ye RD, Kwak JY, and Ryu SH. Differential activation of formyl peptide receptor-like 1 by peptide ligands. J Immunol 171: 6807–6813, 2003.[Abstract/Free Full Text]
  6. Bals R, Beisswenger C, Blouquit S, and Chinet T. Isolation and air-liquid interface culture of human large airway and bronchiolar epithelial cells. J Cyst Fibros 3, Suppl 2: 49–51, 2004.[Medline]
  7. Bals R, Wang X, Zasloff M, and Wilson JM. The peptide antibiotic LL-37/hCAP-18 is expressed in epithelia of the human lung where it has broad antimicrobial activity at the airway surface. Proc Natl Acad Sci USA 95: 9541–9546, 1998.[Abstract/Free Full Text]
  8. Bals R and Wilson JM. Cathelicidins–a family of multifunctional antimicrobial peptides. Cell Mol Life Sci 60: 711–720, 2003.[CrossRef][Medline]
  9. Banks-Schlegel SP, Gazdar AF, and Harris CC. Intermediate filament and cross-linked envelope expression in human lung tumor cell lines. Cancer Res 45: 1187–1197, 1985.[Abstract/Free Full Text]
  10. Boyden S. The chemotactic effect of mixtures of antibody and antigen on polymorphonuclear leucocytes. J Exp Med 115: 453–466, 1962.[Abstract]
  11. Chen CIU, Schaller-Bals S, Paul KP, Wahn U, and Bals R. Beta-defensin and LL-37 in bronchalveolar lavage fluid of patients with cystic fibrosis. J Cystic Fibrosis 3: 45–50, 2004.
  12. Cowland J, Johnsen A, and Borregaard N. hCAP-18, a cathelin/pro-bactenecin-like protein of human neutrophil specific granules. FEBS Lett 368: 173–176, 1995.[CrossRef][Web of Science][Medline]
  13. Elssner A, Duncan M, Gavrilin M, and Wewers MD. A novel P2X7 receptor activator, the human cathelicidin-derived peptide LL37, induces IL-1 beta processing and release. J Immunol 172: 4987–4994, 2004.[Abstract/Free Full Text]
  14. Frohm M, Agerberth B, Ahangari G, Stahle-Backdahl M, Liden S, Wigzell H, and Gudmundsson GH. The expression of the gene coding for the antibacterial peptide LL-37 is induced in human keratinocytes during inflammatory disorders. J Biol Chem 272: 15258–15263, 1997.[Abstract/Free Full Text]
  15. Gudmundsson GH, Agerberth B, Odeberg J, Bergman T, Olsson B, and Salcedo R. The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes. Eur J Biochem 238: 325–332, 1996.[Web of Science][Medline]
  16. Heilborn JD, Nilsson MF, Kratz G, Weber G, Sorensen O, Borregaard N, and Stahle-Backdahl M. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. J Invest Dermatol 120: 379–389, 2003.[CrossRef][Web of Science][Medline]
  17. Karp CL, Flick LM, Park KW, Softic S, Greer TM, Keledjian R, Yang R, Uddin J, Guggino WB, Atabani SF, Belkaid Y, Xu Y, Whitsett JA, Accurso FJ, Wills-Karp M, and Petasis NA. Defective lipoxin-mediated anti-inflammatory activity in the cystic fibrosis airway. Nat Immun 5: 388–392, 2004.[CrossRef][Web of Science]
  18. Kim CH, Kim SS, Choi JY, Shin JH, Kim JY, Namkung W, Lee JG, Lee MG, and Yoon JH. Membrane-specific expression of functional purinergic receptors in normal human nasal epithelial cells. Am J Physiol Lung Cell Mol Physiol 287: L835–L842, 2004.[Abstract/Free Full Text]
  19. Knight DA and Holgate ST. The airway epithelium: structural and functional properties in health and disease. Respirology 8: 432–446, 2003.[CrossRef][Web of Science][Medline]
  20. Koczulla R, von Degenfeld G, Kupatt C, Krotz F, Zahler S, Gloe T, Issbrucker K, Unterberger P, Zaiou M, Lebherz C, Karl A, Raake P, Pfosser A, Boekstegers P, Welsch U, Hiemstra PS, Vogelmeier C, Gallo RL, Clauss M, and Bals R. An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. J Clin Invest 111: 1665–1672, 2003.[CrossRef][Web of Science][Medline]
  21. Lehrer RI and Ganz T. Cathelicidins: a family of endogenous antimicrobial peptides. Curr Opin Hematol 9: 18–22, 2002.[CrossRef][Web of Science][Medline]
  22. Michelson PH, Tigue M, Panos RJ, and Sporn PH. Keratinocyte growth factor stimulates bronchial epithelial cell proliferation in vitro and in vivo. Am J Physiol Lung Cell Mol Physiol 277: L737–L742, 1999.[Abstract/Free Full Text]
  23. Pawankar R. Epithelial cells as immunoregulators in allergic airway diseases. Curr Opin Allergy Clin Immunol 2: 1–5, 2002.[Medline]
  24. Puddicombe SM, Polosa R, Richter A, Krishna MT, Howarth PH, Holgate ST, and Davies DE. Involvement of the epidermal growth factor receptor in epithelial repair in asthma. FASEB J 14: 1362–1374, 2000.[Abstract/Free Full Text]
  25. Schaller-Bals S, Schulze A, and Bals R. Increased levels of antimicrobial peptides in tracheal aspirates of newborn infants during infection. Am J Respir Crit Care Med 165: 992–995, 2002.[Abstract/Free Full Text]
  26. Sorensen OE, Cowland JB, Theilgaard-Monch K, Liu L, Ganz T, and Borregaard N. Wound healing and expression of antimicrobial peptides/polypeptides in human keratinocytes, a consequence of common growth factors. J Immunol 170: 5583–5589, 2003.[Abstract/Free Full Text]
  27. Tjabringa GS, Aarbiou J, Ninaber DK, Drijfhout JW, Sorensen OE, Borregaard N, Rabe KF, and Hiemstra PS. The antimicrobial peptide LL-37 activates innate immunity at the airway epithelial surface by transactivation of the epidermal growth factor receptor. J Immunol 171: 6690–6696, 2003.[Abstract/Free Full Text]
  28. Vermeer PD, Einwalter LA, Moninger TO, Rokhlina T, Kern JA, Zabner J, and Welsh MJ. Segregation of receptor and ligand regulates activation of epithelial growth factor receptor. Nature 422: 322–326, 2003.[CrossRef][Medline]
  29. Whitsett JA. Intrinsic and innate defenses in the lung: intersection of pathways regulating lung morphogenesis, host defense, and repair. J Clin Invest 109: 565–569, 2002.[CrossRef][Web of Science][Medline]
  30. Yang D, Biragyn A, Hoover DM, Lubkowski J, and Oppenheim JJ. Multiple roles of antimicrobial defensins, cathelicidins, and eosinophil-derived neurotoxin in host defense. Annu Rev Immunol 22: 181–215, 2004.[CrossRef][Web of Science][Medline]
  31. Yang D, Chen Q, Schmidt AP, Anderson GM, Wang JM, Wooters J, Oppenheim JJ, and Chertov O. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T-cells. J Exp Med 192: 1069–1074, 2000.[Abstract/Free Full Text]
  32. Zahm JM, Debordeaux C, Raby B, Klossek JM, Bonnet N, and Puchelle E. Motogenic effect of recombinant HGF on airway epithelial cells during the in vitro wound repair of the respiratory epithelium. J Cell Physiol 185: 447–453, 2000.[CrossRef][Web of Science][Medline]
  33. Zaiou M, Nizet V, and Gallo RL. Antimicrobial and protease inhibitory functions of the human cathelicidin (hCAP18/LL-37) prosequence. J Invest Dermatol 120: 810–816, 2003.[CrossRef][Medline]
  34. Zasloff M. Antimicrobial peptides of multicellular organisms. Nature 415: 389–395, 2002.[CrossRef][Medline]



This article has been cited by other articles:


Home page
Mol Cancer ResHome page
S. B. Coffelt, S. L. Tomchuck, K. J. Zwezdaryk, E. S. Danka, and A. B. Scandurro
Leucine Leucine-37 Uses Formyl Peptide Receptor-Like 1 to Activate Signal Transduction Pathways, Stimulate Oncogenic Gene Expression, and Enhance the Invasiveness of Ovarian Cancer Cells
Mol. Cancer Res., June 1, 2009; 7(6): 907 - 915.
[Abstract] [Full Text] [PDF]


Home page
Antimicrob. Agents Chemother.Home page
A. Bjorstad, G. Askarieh, K. L. Brown, K. Christenson, H. Forsman, K. Onnheim, H.-N. Li, S. Teneberg, O. Maier, D. Hoekstra, et al.
The Host Defense Peptide LL-37 Selectively Permeabilizes Apoptotic Leukocytes
Antimicrob. Agents Chemother., March 1, 2009; 53(3): 1027 - 1038.
[Abstract] [Full Text] [PDF]


Home page
J Antimicrob ChemotherHome page
R. Bucki, A. G. Sostarecz, F. J. Byfield, P. B. Savage, and P. A. Janmey
Resistance of the antibacterial agent ceragenin CSA-13 to inactivation by DNA or F-actin and its activity in cystic fibrosis sputum
J. Antimicrob. Chemother., September 1, 2007; 60(3): 535 - 545.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
R. Shaykhiev and R. Bals
Interactions between epithelial cells and leukocytes in immunity and tissue homeostasis
J. Leukoc. Biol., July 1, 2007; 82(1): 1 - 15.
[Abstract] [Full Text] [PDF]


Home page
Proc Am Thorac SocHome page
E. Puchelle, J.-M. Zahm, J.-M. Tournier, and C. Coraux
Airway Epithelial Repair, Regeneration, and Remodeling after Injury in Chronic Obstructive Pulmonary Disease
Proceedings of the ATS, November 1, 2006; 3(8): 726 - 733.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
P. G. Barlow, Y. Li, T. S. Wilkinson, D. M. E. Bowdish, Y. E. Lau, C. Cosseau, C. Haslett, A. J. Simpson, R. E. W. Hancock, and D. J. Davidson
The human cationic host defense peptide LL-37 mediates contrasting effects on apoptotic pathways in different primary cells of the innate immune system
J. Leukoc. Biol., September 1, 2006; 80(3): 509 - 520.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow All Versions of this Article:
289/5/L842    most recent
00286.2004v1
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in ISI Web of Science
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via ISI Web of Science (24)
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Shaykhiev, R.
Right arrow Articles by Bals, R.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Shaykhiev, R.
Right arrow Articles by Bals, R.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
Visit Other APS Journals Online
Copyright © 2005 by the American Physiological Society.